PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_08040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-PHD
Protein Properties Length: 813aa    MW: 90464.3 Da    PI: 6.6136
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_08040genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.54.6e-135596001455
                 HHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  14 eLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  L e+F++n+yp++e+r  LA++lgLt +qV+ WF N R   
  PEQU_08040 559 KLYEAFQENQYPTKESRDSLAQELGLTFKQVSKWFLNARHNS 600
                 6999**********************************9765 PP

2Homeobox44.82.1e-14643694556
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 t+++++ l+ L e+F++n+yps+e+reeLA++lg+t ++V+ WF   R + +
  PEQU_08040 643 TSPNATRLKKLDEAFQENQYPSREKREELAQELGITIQKVTRWFEHARRRSR 694
                 7889999*****************************************9987 PP

3PHD414.2e-14239294151
                 SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
         PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                 +C  Cg+    ++++++lCdg C++ fH+ Cl+++l se++p g   wlC+eC++k
  PEQU_08040 239 FCGKCGSkdVSADNDIILCDGiCERGFHQTCLNPPLLSEDIPTGdeGWLCPECDCK 294
                 699999976667********88********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579039.97E-15229297IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.7E-13236294IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.994237294IPR019787Zinc finger, PHD-finger
CDDcd155043.77E-26239291No hitNo description
PfamPF006281.8E-11239294IPR019787Zinc finger, PHD-finger
SMARTSM002491.0E-10239292IPR001965Zinc finger, PHD-type
PROSITE patternPS013590240291IPR019786Zinc finger, PHD-type, conserved site
SMARTSM003893.1E-9551607IPR001356Homeobox domain
SuperFamilySSF466895.99E-12558610IPR009057Homeodomain-like
CDDcd000867.13E-11558601No hitNo description
Gene3DG3DSA:1.10.10.603.1E-13558607IPR009057Homeodomain-like
PfamPF000461.7E-10559600IPR001356Homeobox domain
PROSITE profilePS5007113.815560603IPR001356Homeobox domain
PROSITE patternPS000270578601IPR017970Homeobox, conserved site
SMARTSM003891.9E-11638700IPR001356Homeobox domain
CDDcd000862.79E-11643694No hitNo description
PfamPF000468.2E-12643694IPR001356Homeobox domain
SuperFamilySSF466891.75E-12646707IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-14646702IPR009057Homeodomain-like
PROSITE profilePS5007114.738649696IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MASPEKQKGK KTISRSKKRS KPQKQDSSPG CSGSKLLKSG ISGSQKDGPE EQTGQSELLL  60
TFIKQSKKAN MVNGAAKLSN KSACKRKKAL PKLRRSYSLR SLDKGRVLRS KVDAAKCKTS  120
ENLANNPENL VTRKKKNRKK KENNPGQNEL SRIIKHVRYM LNRMNYEQSL IDAYSGDGWK  180
GQSADKIRPE KELERAKSEI LRCKLKIREI FQRLDSLLAE GRLQESLFDS DGIDSEDIFC  240
GKCGSKDVSA DNDIILCDGI CERGFHQTCL NPPLLSEDIP TGDEGWLCPE CDCKVDCIDL  300
LSEFRGIDLS IEDSWERIFP EAAVLANGNG QYDNLNLPSD DSEDDDYDPN AQRVDVDEQV  360
DGLDHEESDS SSSSYDSTSS DENMNQATVE LPTDDSEDDE FDPDAPDPDK EVHKSNPSSD  420
ESDFTSDSDE FCAELKKTAH AKEASASSQL NVNILIDSDI DEMNDDDKLN DCSEMPSAKL  480
EMDEEESGLR LSNKRSRERL DYKKLYDVAK DSSVKTTPKS CKKNSNSSSA KENHGPQEPD  540
SGGCNSSAGL KKSAVGSKKL YEAFQENQYP TKESRDSLAQ ELGLTFKQVS KWFLNARHNS  600
RVSAKKSSNV GMTTFEVPIR RDTLSNSSKP NEGVTTKSTI LATSPNATRL KKLDEAFQEN  660
QYPSREKREE LAQELGITIQ KVTRWFEHAR RRSRASIKKS HNPATWSPDK PEASCSTPNS  720
QKLNILEEDK TTEPTTPNKA IVLTTTSTSY AKPNDNGVSA RNEFNTTPKS SLSPQKLYSP  780
IANGAASSEK GTNSVNDRRK AIAKELRRMR KAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132141RKKKNRKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotP466051e-121HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLJ3KVP81e-143J3KVP8_ORYBR; Uncharacterized protein
STRINGOB01G10540.11e-142(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-84Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain